PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn356431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 302aa    MW: 33086.4 Da    PI: 9.6996
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn356431genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.8e-1492136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
       Achn356431  92 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 136
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99785141IPR017930Myb domain
SuperFamilySSF466894.71E-1787142IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-1788139IPR006447Myb domain, plants
SMARTSM007171.8E-1089139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1191136IPR009057Homeodomain-like
PfamPF002491.7E-1192136IPR001005SANT/Myb domain
CDDcd001671.69E-992137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTSPSCCSES GADRGNSVAS GGSGGEIMLF GVRVKVDPMR KSVSMNNLSQ YEQPQQEASN  60
VAVDLAAVGY ASADEAVHHQ SSGNRERKRG VPWTEEEHKL FLLGLQKVGK GDWRGISRNF  120
VKTRTPTQVA SHAQKYFLRR SNLNRRRRRS SLFDITTESV TAIPMEEEKV HQESKTQPLL  180
PQTLLPPLEA TNINVSQVLP FPVTISPVLV PAQIENPMEK LTLGQVDHAN HNSAKPIRPI  240
PVLPNPNGTM ADQSLNQKLT VDPSPLSLRL SLSSDHNQVS RYSAFQVMSS FNNGDKIISV  300
T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802855.11e-102PREDICTED: transcription factor MYB1R1-like
RefseqXP_012080161.11e-102PREDICTED: transcription factor MYB1R1
RefseqXP_016493779.11e-102PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B05e-90MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLF8SPH01e-108F8SPH0_CAMSI; MYB transcription factor 1
STRINGSolyc06g071230.2.13e-91(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.21e-56MYB_related family protein